PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009786324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 441aa    MW: 50538.4 Da    PI: 5.6567
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009786324.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3242.9e-99574303374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +lL ecA+a+s++d +++++lL+ l+elasp+gd +q+la+yf++AL  + ++++ ++yk+l++ ++++k+ +++ +    f+evsP+ +f+h++
  XP_009786324.1  57 RLLRECATAISEKDSTKIHHLLWMLNELASPYGDCNQKLAFYFLQALFCKATDTGLRCYKTLTSAAEKSKSFDSSRKLILKFQEVSPWTTFGHVA 151
                     7899**********************************************************9999987666666566666************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl.vakrledlel 191
                      N aIlea++ge+++HiiD++ + ++QWp+Ll+aLa+R++++p+l++T+v+ +++  k  ++e+++r++kfA+ +gvpfefnv+   ++l++l+ 
  XP_009786324.1 152 SNGAILEALDGESKLHIIDISHTFCTQWPTLLEALATRNDETPHLKLTVVVTESTLVKSVMKEVAQRMEKFARLMGVPFEFNVIsGLNHLKELTK 246
                     ****************************************************9999***************************95567******* PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..nsesFlerflealeyysalfdsleaklpreseerik 284
                     ++L++k++Ea+aVn++ +l ++      +e+ r +v+++++sl+Pk+v++ve+ead   ++++F++ f e+l++y+  f++l++++p +s+er +
  XP_009786324.1 247 DSLNIKEEEAVAVNCIGALRKVE-----VEE-RGDVIRMLQSLNPKIVTIVEHEADFssTRNDFVKCFEECLRFYTLYFEMLDESFPITSNERLV 335
                     ********************997.....444.889*******************999545669******************************** PP

            GRAS 285 vErellgreivnvvace...gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.....eesgslvlgWkdrpLvsvS 371
                     +Ere  +++iv+v+ac    g+   e +e+ ++W+erl+e  F+p pl+++a++++k+ll+++k  g+++      +es  ++l+W+d+p+v++S
  XP_009786324.1 336 IERE-CSKSIVKVLACGdqiGEGDGETRERGNQWSERLREW-FSPFPLNDDAVDDVKSLLKRYK-AGWSLVlpqenQESPGIYLTWRDEPVVWTS 427
                     ****.89*********72223446799999********997.**********************.666665556556688899************ PP

            GRAS 372 aWr 374
                     aW+
  XP_009786324.1 428 AWK 430
                     **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.92629406IPR005202Transcription factor GRAS
PfamPF035141.0E-9657430IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MEKSLFFSKP TNNFLVTNYV HHLINMQNPN QQPHENSSRS QSPENGDPVS DAKWASRLLR  60
ECATAISEKD STKIHHLLWM LNELASPYGD CNQKLAFYFL QALFCKATDT GLRCYKTLTS  120
AAEKSKSFDS SRKLILKFQE VSPWTTFGHV ASNGAILEAL DGESKLHIID ISHTFCTQWP  180
TLLEALATRN DETPHLKLTV VVTESTLVKS VMKEVAQRME KFARLMGVPF EFNVISGLNH  240
LKELTKDSLN IKEEEAVAVN CIGALRKVEV EERGDVIRML QSLNPKIVTI VEHEADFSST  300
RNDFVKCFEE CLRFYTLYFE MLDESFPITS NERLVIEREC SKSIVKVLAC GDQIGEGDGE  360
TRERGNQWSE RLREWFSPFP LNDDAVDDVK SLLKRYKAGW SLVLPQENQE SPGIYLTWRD  420
EPVVWTSAWK PWEKSMERHD Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-368543033375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap